PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000209471
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 303aa    MW: 34161.5 Da    PI: 9.8694
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000209471genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding254.6e-082467344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     rWT+ E + + +a + + ++   +W+++a++++ g+t  ++   +
    MDP0000209471 24 RWTPAENKMFENALAXYDKDapdRWHKVAEMIP-GKTVRDVMKQY 67
                     8********************************.***99998766 PP

2Myb_DNA-binding48.22.5e-15133177347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
    MDP0000209471 133 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVVTRTPTQVASHAQKY 177
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-41969IPR009057Homeodomain-like
PROSITE profilePS512938.5722075IPR017884SANT domain
SMARTSM007174.4E-82173IPR001005SANT/Myb domain
SuperFamilySSF466893.14E-102270IPR009057Homeodomain-like
PfamPF002492.4E-62467IPR001005SANT/Myb domain
CDDcd001671.09E-72470No hitNo description
PROSITE profilePS5129421.817126182IPR017930Myb domain
SuperFamilySSF466896.88E-17128181IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-18129181IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.9E-13130177IPR009057Homeodomain-like
SMARTSM007172.7E-13130180IPR001005SANT/Myb domain
PfamPF002495.3E-13133177IPR001005SANT/Myb domain
CDDcd001671.31E-11133178No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MEILSPSSYF STSNRLVEES KXARWTPAEN KMFENALAXY DKDAPDRWHK VAEMIPGKTV  60
RDVMKQYEEL ELDVGKIEAG LIPIPGYSPS PFTLEWVNRH GGYDGFKQXS YGIGGKRSSS  120
NRPSDHERKK GVPWTEEEHK LFLMGLKKYG KGDWRNISRN FVVTRTPTQV ASHAQKYFIR  180
QLSGGKDKRR ASIHDITTVN LNDMRTPSPD NKSPLSPELP QHPNSAATAR APFQWHQPQG  240
GGVNLGFNQG HGNMFMSSHP YGISSYGQKM QGQDLHKGAA NNLYYGPQNL GFQMQSSQHY  300
PHG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1525871173RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.120453e-89flower| fruit| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008355344.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-136DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM5VZC70.0M5VZC7_PRUPE; Uncharacterized protein
STRINGVIT_06s0004g06100.t011e-163(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-102MYB family protein